PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.6864s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family MYB
Protein Properties Length: 1647aa    MW: 180365 Da    PI: 6.8177
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.6864s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.3e-11869910346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT eE e++++  +++G++ +k+Ia+++   +t  +c+++++k
  Bostr.6864s0019.1.p 869 PWTSEEKEIFLNMLAMHGKD-FKKIASYLT-QKTTADCIDYYYK 910
                          8*****************99.********9.9**********98 PP

2Myb_DNA-binding28.73.1e-0910841125447
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                           WT +E   +++++ ++G++ +++I+r++g +R++ qc+ ++ k+
  Bostr.6864s0019.1.p 1084 WTDDERSAFIQGFSLFGKN-FASISRYVG-TRSPDQCRVFFSKV 1125
                           *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-14852913IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-7861912IPR009057Homeodomain-like
PROSITE profilePS5129315.343865916IPR017884SANT domain
SMARTSM007177.4E-10866914IPR001005SANT/Myb domain
PfamPF002492.6E-9868910IPR001005SANT/Myb domain
CDDcd001673.20E-8869911No hitNo description
PROSITE profilePS5129312.76110791130IPR017884SANT domain
SMARTSM007173.5E-810801128IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-910831130IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-510831124IPR009057Homeodomain-like
CDDcd001674.36E-710841125No hitNo description
PfamPF002499.0E-810841124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1647 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEQSFDSPF RWRDSPTTPS SHHVPREFSR WGSGDFRRPS  60
CHGKQGGRHQ FVEESSHGYT SSRSSVRIFE NDYYRPSASR GDWRYTRNCR DDRVSVSQKE  120
WKCNTWEMGN GSSRNFERPF GIRNGRRSVD ERPLHASDTH TIVVNSLDPA NSAHQPDTEI  180
CTPVQSLKFK NVQKFSDQRL SLPLDPHSDC VSLFERPSSE NNYGSKVCSP AKQCSDLMYG  240
RRIANDNSLD PPILNAELEG TWEQLHLKDP QDNNRLHGIS DLDGARKCAK ESSLGAIGKL  300
PLWNSSGSFA SQSSGFSHSS SLKSLGAVDS SDQKTEVLPK IVTVTQSSSG DATGCATTTH  360
LSEEMSSRKK QRLGWGEGLA KYEKKKVDVN TNEDGTTLLE NGSEELHSLN QNIADTSPTA  420
AIVPDYGSPT TPSSVACSSS PGFADKSSAK AAIAASDVSN MCRSPSSVSS IHLERFPINI  480
EELDNISMER FGCLLNELLG TDDPGTGDSS SVQLTSMNRL LAWKSEILKA VEMTESEIDL  540
LENKHRMLKL EGGRHCHVVG PSSYFCEGDA NMPKEQEASC ILGPKAAASS VAETLVRAPV  600
HQSGLAKVPV DVFEDNPGEV KSLSHSFATV ESNEAILPIP SMKAAASSKE INTFVNQETI  660
ELSSADDSMA SNEDLLCAKL LSSNKKYACE SSGVFNELLP RDFCSFDESR FPGICQTQFD  720
SHVKEKIADR VELLRAREKI LLLQFKAFQL SWKKDVTQLA LTKYQSKSSK KTELYPNAKN  780
GGYLKLPQPV RLRFSSSAPK RDSVVPTTEL LSYMEKLLPG THLKPFRDIL RMPAMILDEK  840
ERVMSRFISS NGLVEDPCDV EKERTMINPW TSEEKEIFLN MLAMHGKDFK KIASYLTQKT  900
TADCIDYYYK NHKSDCFGKI KKQRAYGKEG KHTYMLAPRK KWKREMGAAS LDILGAVSII  960
AANAGKVAST RPISSKRITL RGCSSSNSLQ HDGNNSEGCS YSFDFPRKRT VGADVLAVGP  1020
LSSEQINSCL RTSVSSRERC MDHLRFNPVV KKPRISHTLH NENSNEEDDS CSEESCGETG  1080
PIHWTDDERS AFIQGFSLFG KNFASISRYV GTRSPDQCRV FFSKVRKCLG LEFIQSGAGN  1140
VSTSVSVDNG NEGGGSDLED PCPMESNSGI CNNGDCGKMD MNSPTSPFNM NQDGANHSGS  1200
ANVKADLSRS EQDNGLTYLR LKDGSNLVNN AYINGGFPGL VSESCRDLVD INTVDSPSQA  1260
AGKSKSNDLL SMEIDEGVLT SVAVSSEPLY CGLSVLSNVI VETPTESSRK GSGDQCSKNQ  1320
DGVMQAANRT RNSGLEPESA PSGFKYPECL HHVPIEVCTE NPIGVSVPRG NPNCHTEAKS  1380
GNSLVGQAVG THDLGWQSSK DNLELNGRLQ VIGHVNPEQN GQLNANNAEY CQIPQRSVTQ  1440
DPSRISRSKS DLIVKTQRTG EGFSLNKCTS SAPNPLAVSH KEGRSGHSRS HSFSLSDTER  1500
LDKNEDVKLF GTVLTADENG IKQKHNPCGS VRSSSTLSRD HDTRHHYINQ QHLQNVPITS  1560
YGFWDGNRIQ TGLTSLPESA KLLASCPEAF STHLKQQVGS SKEIQLDVNG GGILSFGKHN  1620
EDRADASSAK DGGNIGGVNG VAEAAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-16827917493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-16827917493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876132.10.0myb family transcription factor
TrEMBLD7LU400.0D7LU40_ARALL; Myb family transcription factor
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein